PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G080000.1.p
Common NameLOC101753232, SETIT_036412mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 350aa    MW: 37380.3 Da    PI: 6.7945
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G080000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.61.1e-31222277156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH++Fv a++qLGG+++AtPk+i+e+m+v+gLt+++vkSHLQkYRl+
  Seita.9G080000.1.p 222 KARRCWSPELHRQFVAALHQLGGPQVATPKQIREVMQVDGLTNDEVKSHLQKYRLH 277
                         68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.744219279IPR017930Myb domain
SuperFamilySSF466891.25E-16220280IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-28220280IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-25222277IPR006447Myb domain, plants
PfamPF002491.2E-7224275IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MGLDVAEIGM GLDLGLDLKL FAARSAGGMA AAAAKGAPAG IEACIRSLEE ERRKIEVFRR  60
ELPLCVRLLA DVIEELKDEA AKRGEDLELE MKADDGDKKK WMSTAQLWVD SDAKSKSEKE  120
KRSEMTSPEP KLLGSPMPIR AVPAVAPPPP PCFRGDDNAA STVGLPGLSL LPPAAKTSIS  180
PAPAVDEHRQ NATARFSAPM SPSGPALNLH AQTQQQQQQA RKARRCWSPE LHRQFVAALH  240
QLGGPQVATP KQIREVMQVD GLTNDEVKSH LQKYRLHNRR SPGVAPVSQS IMLVGGLWVP  300
QEQTSSQSGS PQGPLQFSGS GMAVSAATVG GDGSSSDEDD KSDESYSRK*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00475DAPTransfer from AT4G37180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9620861e-102EU962086.1 Zea mays clone 240112 DNA binding protein mRNA, complete cds.
GenBankKJ7280551e-102KJ728055.1 Zea mays clone pUT6201 G2-like transcription factor (GLK44) mRNA, partial cds.
GenBankKJ7280561e-102KJ728056.1 Zea mays clone pUT6202 G2-like transcription factor (GLK44) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981657.10.0PREDICTED: probable transcription factor GLK1
TrEMBLK4AC050.0K4AC05_SETIT; Uncharacterized protein
STRINGSi036412m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP181737107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G25790.12e-30G2-like family protein